RPT0015
Recombinant Human IgE Protein
Size
£145.00
- SKU:
- RPT0015
- Additional Names:
- Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE, IgE
- Molecular Weight:
- 45-60 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser106-Gly427
- Formulation:
- Recombinant Human IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser106-Gly427) of Human IgE (Accession #AAB59395.1 ) fused with a His tag at the C-terminus.
- Species:
- Human
- Sequence:
- SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
- Uniprot:
- P01854
- Synonyms:
- constant region of heavy chain of IgE;Ig epsilon chain C region;Ig epsilon chain C region ND;IgE;immunoglobulin epsilon
- Extra Details:
- Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to be located in extracellular region. Predicted to be part of immunoglobulin complex, circulating. Predicted to be active in external side of plasma membrane.
- Shipping Conditions:
- Blue Ice