RPT0004
Recombinant Human IgG1 Protein

Size
£145.00
- SKU:
- RPT0004
- Additional Names:
- Human IgG,IGHG1,human IgG (Fc),g gamma-1 chain C region
- Molecular Weight:
- 35-40 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Pro100-Lys330
- Formulation:
- Recombinant Human IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro100-Lys330) of human IgG1 Fc fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Uniprot:
- P01857
- Synonyms:
- constant region of heavy chain of IgG1;Ig gamma-1 chain C region;Ig gamma-1 chain C region EU;Ig gamma-1 chain C region KOL;Ig gamma-1 chain C region NIE;immunoglobulin gamma 1 (Gm marker)
- Extra Details:
- As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcG GammaR ) on phagocytic cells with high affinity. Fc fragment is demonstrated to mediate phagocytosis, trigger inflammation, and target Ig to particular tissues. Protein G or Protein A on the surface of certain Staphylococcal and Streptococcal strains specifically binds with the Fc region of IgGs, and has numerous applications in biotechnology as a reagent for affinity purification. Recombinant IgG Fc Region is suggested to represent a potential anti-inflammatory drug for treatment of human autoimmune diseases.
- Shipping Conditions:
- Blue Ice



