RP03505
Recombinant Human IL-1 alpha Protein
Size
£145.00
- SKU:
- RP03505
- Additional Names:
- IL1A, IL1F1, Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1
- Molecular Weight:
- 15-20 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser113-Ala271
- Formulation:
- Recombinant Human IL-1 alpha Protein is produced by E. coli Cells system. The target protein is expressed with sequence (Ser113-Ala271) of Human IL-1 alpha (Accession #NP_000566.3) fused with No tag .
- Species:
- Human
- Sequence:
- SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
- Uniprot:
- P01583
- Synonyms:
- hematopoietin-1;IL-1 alpha;IL-1A;IL1;IL1-ALPHA;IL1F1;interleukin-1 alpha;preinterleukin 1 alpha;pro-interleukin-1-alpha
- Extra Details:
- The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
- Shipping Conditions:
- Blue Ice