Recombinant Human Inhibin beta E/INHBE Protein

Size

£193.00

SKU:: RP03275
Additional Names:: INHBE,Inhibin beta E chain, Activin beta-E chain
Molecular Weight:: 40-50 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Thr237-Ser350
Formulation:: Recombinant Human Inhibin beta E/INHBE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr237-Ser350) of human Inhibin beta E/INHBE (Accession #NP_113667.1) fused with hFc tag at the N-terminus.
Species:: Human
Sequence:: TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Uniprot:: P58166
Synonyms:: activin beta-E chain;inhibin beta E chain;inhibin beta E subunit
Extra Details:: The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth.