RP03266
Recombinant Human R-spondin-2/RSPO2 Protein
Size
£193.00
- SKU:
- RP03266
- Additional Names:
- R-spondin-2, Roof plate-specific spondin-2, hRspo2,RSPO2, UNQ9384/PRO34209
- Molecular Weight:
- 55-60 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala32-Gly205
- Formulation:
- Recombinant Human R-spondin-2/RSPO2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala32-Gly205) of human R-spondin-2 (Accession #Q6UXX9) fused with hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG
- Uniprot:
- Q6UXX9-1
- Synonyms:
- CRISTIN2;HHRRD;R-spondin 2 homolog;R-spondin-2;roof plate-specific spondin-2;TETAMS2
- Extra Details:
- R-spondins are secretory proteins localized in the endoplasmic reticulum and Golgi bodies and are processed through the secretory pathway. The RSPO family comprises four proteins, i.e., R-spondin 1-4, which are important secreted regulators of the Wnt/-catenin and Wnt/PCP signaling pathway and govern various functions and are involved in vital cellular processes such as stem cell renewal, morphogenesis and, tumorigenesis. Among the R-spondin family, R-spondin-2, is a key protein that regulates ligand-dependent -catenin signaling. And it has been reported to play a pivotal role in myogenesis, osteoblast differentiation, and limb specification during embryonic development.
- Shipping Conditions:
- Blue Ice