Recombinant Mouse Siglec-10 Protein

Size

£163.00

SKU:: RP03262
Additional Names:: MGC126774|PRO940|sialic acid-binding Ig-like lectin 10|Siglec-10|Siglec-G|siglec-like gene 2|Siglec-like protein 2|SIGLEC10|SiglecG|SLG2|SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7
Molecular Weight:: 110-135 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met19-Lys543
Formulation:: Recombinant Mouse Siglec-10 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met19-Lys543) of mouse Siglec-10 (Accession #Q80ZE3) fused with hFc tag at the C-terminus.
Species:: Mouse
Sequence:: MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK
Uniprot:: Q80ZE3
Synonyms:: 9830164H23;A630096C01Rik;mSigle;mSiglec-G;sialic acid binding Ig-like lectin 10;sialic acid-binding Ig-like lectin 10;Sialic acid-binding Ig-like lectin G;siglec-10;Siglec-G;Siglec10
Extra Details:: Siglecs (sialic acid binding Ig-like lectins) belong to the immunoglobulin superfamily. Siglec-G is the apparent ortholog of human Siglec-10. It is expressed by mature B cells, but significant levels of transcript were also detected in DC, myeloid cells, and to a lesser extent, T cells. Mature Siglec-G consists of a 526 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 124 aa cytoplasmic domain. Siglec-G is a member of the CD33-related Siglec family in the mouse, and is involved in negative regulation of B-cell antigen receptor signaling and specifically acts on B1 cells to inhibit Ca2+ signaling, cellular expansion and antibody secretion.

Shipping Conditions:: Blue Ice