RP03258
Recombinant Human NUDT5 Protein
Size
£395.00
- SKU:
- RP03258
- Additional Names:
- ADP-sugar pyrophosphatase|HSPC115|Nudix motif 5|NUDIX5|NUDT5|YSA1|YSA1H
- Molecular Weight:
- 30-35 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Phe219
- Formulation:
- Recombinant Human NUDT5 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Phe219) of human NUDT5 (Accession #Q9UKK9) fused with His tag at the N-terminus.
- Species:
- Human
- Sequence:
- MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
- Uniprot:
- Q9UKK9
- Synonyms:
- 8-oxo-dGDP phosphatase;ADP-sugar pyrophosphatase;hNUDT5;nuclear ATP-synthesis protein NUDIX5;Nucleoside diphosphate-linked moiety X motif 5;nudix (nucleoside diphosphate linked moiety X)-type motif 5;YSA1;YSA1H;YSAH1
- Extra Details:
- NUDIX hydrolase type 5 (NUDT5) is a kind of ADP-ribose pyrophosphatase and nucleotide metabolizing enzyme that can either act as an ADP-sugar pyrophosphatase in absence of diphosphate or catalyze the synthesis of ATP in presence of diphosphate. In absence of diphosphate, NUDT5 hydrolyzes with similar activities various modified nucleoside diphosphates such as ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. In presence of diphosphate, NUDT5 mediates the synthesis of ATP in the nucleus by catalyzing the conversion of ADP-ribose to ATP and ribose 5-phosphate.
- Shipping Conditions:
- Blue Ice