RP03256
Recombinant Human NDRG1 Protein

Size
£431.00
- SKU:
- RP03256
- Additional Names:
- CAP43|CMT4D|Differentiation-related gene 1 protein|DRG1|GC4|HMSNL|N-myc downstream-regulated gene 1 protein|NDR1|NDRG1|NMSL|PROXY1|Reducing agents and tunicamycin-responsive protein|RIT42|RTP|TARG1|TDD5
- Molecular Weight:
- 40-45 kDa
- Purity:
- ≥85%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Cys394
- Formulation:
- Recombinant Human NDRG1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys394) of human NDRG1 (Accession #Q92597) fused with His tag at the C-terminus.
- Species:
- Human
- Sequence:
- MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
- Uniprot:
- Q92597
- Synonyms:
- CAP43;CMT4D;differentiation-related gene 1 protein;DRG-1;DRG1;GC4;HMSNL;N-myc downstream-regulated gene 1 protein;NDR1;nickel-specific induction protein Cap43;NMSL;protein NDRG1;protein regulated by oxygen-1;PROXY1;reducing agents and tunicamycin-responsive protein;RIT42;RTP;TARG1;TDD5
- Extra Details:
- NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. NDRG1 is necessary for p53-mediated caspase activation and apoptosis. Mutations in the NDRG1 gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer.
- Shipping Conditions:
- Blue Ice

