RP03255
Recombinant Human REG3G Protein

Size
£526.00
- SKU:
- RP03255
- Additional Names:
- Pancreatitis-associated protein 1B|PAP1B|REG-3-gamma|REG3G|Regenerating islet-derived protein 3-gamma
- Molecular Weight:
- 15-20 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Asp175
- Formulation:
- Recombinant Human REG3G Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp175) of human REG3G (Accession #Q6UW15) fused with His tag at the C-terminus.
- Species:
- Human
- Sequence:
- MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
- Uniprot:
- Q6UW15
- Synonyms:
- LPPM429;pancreatitis-associated protein 1B;pancreatitis-associated protein IB;PAP IB;PAP-1B;PAP1B;PAPIB;REG III;reg III-gamma;REG-3-gamma;REG-III;regenerating gene III;regenerating islet-derived 3 gamma;regenerating islet-derived protein 3-gamma;regenerating islet-derived protein III-gamma;UNQ429
- Extra Details:
- Regenerating islet-derived 3 gamma (REG3G), also known as pancreatitis-associated protein 1B (PAP1B), is a member of the secreted Reg superfamily and contains one typical C-type lectin domain. REG3G is expressed weakly in pancreas, strongly in intestinal tract, but not in hyperplastic islets REG3G might be a stress protein involved in the control of bacterial proliferation. It was indicated that REG3G specifically targets Gram-positive bacteria because it binds to their surface peptidoglycan layer, and serves as one of several antimicrobial peptides produced by paneth cells via stimulation of toll-like receptors (TLRs) by pathogen-associated molecular patterns (PAMPs).
- Shipping Conditions:
- Blue Ice

