Recombinant Mouse PDGF-AA Protein

Size

£574.00

SKU:: RP03145
Additional Names:: PDGF-A|PDGF1|PDGFA
Molecular Weight:: 20&26 KDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser87-Arg196
Formulation:: Recombinant Mouse PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Arg196) of Mouse PDGF-AA (Accession #NP_032834.1) fused with a 6xHis tag at the N-terminus.
Species:: Mouse
Sequence:: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR
Uniprot:: P20033
Synonyms:: PDGF A-chain;PDGF subunit A;PDGF-1;Platelet-derived growth factor A chain;platelet-derived growth factor A-chain;platelet-derived growth factor alpha polypeptide;platelet-derived growth factor subunit A
Extra Details:: Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.