Recombinant Mouse IL-2 R beta/CD122 Protein

Size

£574.00

SKU:: RP03105
Additional Names:: CD122|IL-15Rbeta|Il-2/15Rbeta|Il-2Rbeta|IL15Rbeta|p70
Molecular Weight:: 45-54 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala27-Glu240
Formulation:: Recombinant Mouse IL-2 R beta/CD122 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Glu240) of Mouse IL-2 R beta/CD122 (Accession #NP_032394.1) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Uniprot:: P16297
Synonyms:: CD122;high affinity IL-2 receptor subunit beta;IL-15 receptor beta chain;IL-15R;IL-15Rbeta;IL-2 receptor beta chain;IL-2 receptor subunit beta;IL-2/15 receptor-beta;Il-2/15Rbeta;Il-2R;IL-2R subunit beta;IL-2RB;Il-2Rbeta;IL15R;IL15Rbeta;interleukin-2 receptor subunit beta;p70;p70-75
Extra Details:: Interleukin-2 receptor (IL-2R) also known as High-affinity IL-2 receptor subunit beta, IL-2 receptor subunit beta, and IL-2RB, is involved in T cell-mediated immune responses. CD122/IL-2RB is present in 3 forms concerning the ability to bind interleukin 2. The low-affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high-affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high-affinity forms of CD122/IL-2RB are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. CD122/IL-2RB expression was restricted to the earliest B220+ cells (CD43+CD24-; prepro B cells; fraction A) that proliferate vigorously to IL-2 in the absence of any stromal cells, but not to IL-15. The high-affinity form of this receptor is expressed on activated T lymphocytes, activated B lymphocytes, and activated macrophages. CD122/IL-2RB plays a role in regulating normal lymphocyte development.

Shipping Conditions:: Blue Ice