Recombinant Human Fibrillin-1/FBN1 Protein

Size

£193.00

SKU:: RP02988
Additional Names:: Asprosin|Fbn-1|Fbn1|Fibrillin-1
Molecular Weight:: 25-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser2732-His2871
Formulation:: Recombinant Human Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2732-His2871) of human Fibrillin-1/FBN1 (Accession #NP_000129.3) fused with a 8xHis tag at the N-terminus.
Species:: Human
Sequence:: STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Uniprot:: P35555
Synonyms:: ACMICD;asprosin;ECTOL1;epididymis secretory sperm binding protein;FBN;fibrillin 15;fibrillin-1;fibrillin-1 preproprotein;GPHYSD2;MASS;MFLS;MFS1;OCTD;SGS;SSKS;WMS;WMS2
Extra Details:: Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.

Shipping Conditions:: Blue Ice