Recombinant Human Microfibrillar-associated protein 5 Protein

Size

£621.00

SKU:: RP02966
Additional Names:: AAT9|MAGP-2|MAGP2|MFAP-5|MP25
Molecular Weight:: 29, 54 kDa
Purity:: ≥85%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Leu173
Formulation:: Recombinant Human Microfibrillar-associated protein 5 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Met1-Leu173) of human Microfibrillar-associated protein 5 (Accession #NP_003471.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Uniprot:: Q13361
Synonyms:: AAT9;MAGP-2;MAGP2;MFAP-5;Microfibril-associated glycoprotein 2;microfibril-associated glycoprotein-2;microfibrillar associated protein 5;microfibrillar-associated protein 5;MP25;THE1A-MFAP5
Extra Details:: MFAP5 (Microfibril Associated Protein 5, also known as MAGP2) is a Protein Coding gene. MFAP5 is a component of the elastin-associated microfibrils. It belongs to the MFAP family. As a 25-kD microfibril-associated glycoprotein, MFAP5 is rich in serine and threonine residues. It stimulates the assembly of elastic fibers, a complex structure composed of a tropoelastin inner core and microfibril outer mantle comprising proteins such as fibrillins and microfibril-associated glycoproteins that guide tropoelastin deposition. MFAP5 also stabilizes type 1 procollagen and thus plays an important role in extracellular matrix homeostasis. It has multiple binding regions on fibrillins and has a covalent periodic association with fibrillin-containing microfibrils. Diseases associated with MFAP5 include Aortic Aneurysm, Familial Thoracic 9, and Familial Thoracic Aortic Aneurysm And Aortic Dissection.

Shipping Conditions:: Blue Ice