RP02942
Recombinant Mouse IL-22 Protein
Size
£163.00
- SKU:
- RP02942
- Additional Names:
- IL-22,If2b1,Iltif,IL-22a, ILTIFa,IL22
- Molecular Weight:
- 15 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Leu34-Val179
- Formulation:
- Recombinant Mouse IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu34-Val179) of mouse IL-22 (Accession #NP_058667.1) fused with 6xHis at the C-terminus.
- Species:
- Mouse
- Sequence:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Uniprot:
- Q9JJY9
- Synonyms:
- If2b1;Il;IL-;IL-10-related T-cell-derived-inducible factor;IL-22;IL-22a;IL-TIF alpha;Iltif;ILTIF alpha;ILTIFa;interferon 2b1;interleukin 10-related T cell-derived inducible factor;interleukin-22;interleukin-22a
- Extra Details:
- Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10RB Beta (previously known as CRF2-4), belonging to the class II cytokine receptor family.
- Shipping Conditions:
- Blue Ice