Recombinant Human Aldehyde reductase/AKR1B1 Protein

Size

£526.00

SKU:: RP02938
Additional Names:: AKR1B1, ADR, ALDR1, ALR2, AR, aldose reductase,ADR,ALDR1,ALR2,AR
Molecular Weight:: 36 kda
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Phe316
Formulation:: Recombinant Human Aldehyde reductase/AKR1B1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe316) of human Aldehyde reductase/AKR1B1 (Accession #NP_001619.1) fused with 6xHis tag at the N-terminus.
Species:: Human
Sequence:: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Uniprot:: P15121
Synonyms:: ADR;Aldehyde reductase;aldehyde reductase 1;aldo-keto reductase family 1 member B1;aldose reductase;ALDR1;ALR2;AR;Lii5-2 CTCL tumor antigen;low Km aldose reductase
Extra Details:: Aldose reductase (AKR1B1) belongs to the aldo/keto reductase superfamily. AKR1B1 is a NADPH-dependent aldo-keto reductase best known as the rate-limiting enzyme of the polyol pathway. Expression of AKR1B1 was the highest in lens and retina. It is the first enzyme in the polyol pathway through which glucose is converted to sorbitol which is important for the function of various organs in the body, and has been implicated in the etiology of diabetic complications. AKR1B1 is quite abundant in the collecting tubule cells and thought to provide protection against hypertonic environment. Some human tissues contain AKR1B1 as well as AKR1B10, a closely related member of the aldo-keto reductase superfamily.

Shipping Conditions:: Blue Ice