RP02896
Recombinant Human Placenta growth factor/PlGF-131/PlGF-1 Protein
Size
£145.00
- SKU:
- RP02896
- Additional Names:
- D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760,PGF,PGFL,PIGF,PLGF,PlGF-2,SHGC-10760
- Molecular Weight:
- 55-60 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Leu19-Arg149
- Formulation:
- Recombinant Human Placenta growth factor/PlGF-131/PlGF-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu19-Arg149) fused with a hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR
- Uniprot:
- P49763-2
- Synonyms:
- D12S1900;PGFL;PIGF;placenta growth factor;placental growth factor, vascular endothelial growth factor-related protein;PLGF;PlGF-2;SHGC-10760
- Extra Details:
- Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines (1, 2). Alternative splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively (1, 2). Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus (1). Human PlGF-1 shares 56%, 55%, 74% and 95% aa identity with the comparable isoform of mouse, rat, canine, and equine PlGF, respectively. PlGF is mainly found as variably glycosylated, secreted, 55-60 kDa disulfide linked homodimers (3). Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes, and some endothelial cells (1, 4-6). Circulating PlGF increases during pregnancy, reaching a peak in mid-gestation; this increase is attenuated in preeclampsia (7). However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia (8).
- Shipping Conditions:
- Blue Ice