RP02895
Recombinant Human Macrophage migration inhibitory factor/MIF Protein
Size
POA
- SKU:
- RP02895
- Additional Names:
- GIF, GLIF, MMIF,MIF,GLIF,MMIF
- Molecular Weight:
- 15 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- (Met1-Ala115)
- Formulation:
- Recombinant human Macrophage migration inhibitory factor/MIF Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Ala115) of human Macrophage migration inhibitory factor/MIF (Accession #NP_002406.1) fused with a 6xHis tag at the N-terminus.
- Species:
- Human
- Sequence:
- MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
- Uniprot:
- P14174
- Synonyms:
- epididymis secretory sperm binding protein;GIF;GLIF;Glycosylation-inhibiting factor;L-dopachrome isomerase;L-dopachrome tautomerase;macrophage migration inhibitory factor;macrophage migration inhibitory factor (glycosylation-inhibiting factor);MMIF;phenylpyruvate tautomerase
- Extra Details:
- MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era . Regardless, it is one of the least understood of all inflammatory mediators . Secretion occurs nonclassically via an ABCA1 transporter. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer . Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity.
- Shipping Conditions:
- Blue Ice