Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein

Size

£193.00

SKU:: RP02873
Additional Names:: CGB3,CGB,CGB5,CGB7,CGB8,hCGB
Molecular Weight:: 28-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser21-Gln165
Formulation:: Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Gln165) of Human Choriogonadotropin subunit beta 3/CGB3 (Accession #NP_000728.1) fused with 6xHis tag at the C-terminus.
Species:: Human
Sequence:: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Uniprot:: P0DN86
Synonyms:: CG-beta;CGB;CGB5;CGB7;CGB8;Choriogonadotropin subunit beta;choriogonadotropin subunit beta 3;chorionic gonadotrophin chain beta;chorionic gonadotropin beta 3 subunit;chorionic gonadotropin beta 5 subunit;chorionic gonadotropin beta 8 subunit;chorionic gonadotropin beta chain;chorionic gonadotropin beta subunit 3;chorionic gonadotropin beta subunit 5;chorionic gonadotropin beta subunit 8;chorionic gonadotropin chain beta;chorionic gonadotropin, beta polypeptide;chorionic gonadotropin, beta polypeptide 5;chorionic gonadotropin, beta polypeptide 8;HCG;hCGB;LHB;luteinizing hormone beta subunit
Extra Details:: Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.

Shipping Conditions:: Blue Ice