Recombinant Mouse DLK1 Protein

Size

£353.00

SKU:: RP02871
Additional Names:: DLK|DLK-1|DLK1|FA1|pG2|Pref1|secredeltin|ZOG
Molecular Weight:: 50-68 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE.≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala24-Gln305
Formulation:: Recombinant Mouse DLK1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gln305) of Mouse DLK1 (Accession #NP_034182.2) fused with 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ
Uniprot:: Q09163
Synonyms:: adipocyte differentiation inhibitor protein;AW742678;delta-like 1 homolog;Dl;DLK-1;DlkI;FA;FA1;fetal antigen 1;Ly107;Peg;Peg9;pG;pG2;preadipocyte factor 1;pref;pref-1;protein delta homolog 1;SC;SCP1;stromal cell derived protein 1;ZO;ZOG
Extra Details:: paternally inherited genetic defects of DLK1 were identified in four families with nonsyndromic CPP and a metabolic phenotype. DLK1 encodes a transmembrane protein that is important for adipose tissue homeostasis and neurogenesis and is located in the imprinted chromosome 14q32 region associated with Temple syndrome.

Shipping Conditions:: Blue Ice