Recombinant Mouse LRG1 Protein

Size

£127.00

SKU:: RP02863
Additional Names:: LRG1,HMFT1766,LRG
Molecular Weight:: 45-60 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu33-Leu342
Formulation:: Recombinant Mouse LRG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu33-Leu342) of mouse LRG1 (Accession #NP_084072.1) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
Uniprot:: Q91XL1
Synonyms:: 1300008B03Rik;2310031E04Rik;leucine-rich alpha-2-glycoprotein;Lr;Lrg;Lrhg
Extra Details:: Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.