Recombinant Human Granzyme B/CTLA-1/GZMB Protein

Size

£193.00

SKU:: RP02860
Additional Names:: C11|CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|GZMB|HLP|SECT
Molecular Weight:: 35-40 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly19-Tyr247
Formulation:: Recombinant Human Granzyme B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly19-Tyr247) of human Granzyme B (Accession #NP_004122.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Uniprot:: P10144
Synonyms:: C11;cathepsin G-like 1;CCPI;CGL-1;CGL1;CSP-B;CSPB;CTLA-1;CTLA1;CTSGL1;cytotoxic serine protease B;cytotoxic T-lymphocyte proteinase 2;fragmentin 2;Fragmentin-2;granzyme B;granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1);Granzyme-2;HLP;human lymphocyte protein;SECT;T-cell serine protease 1-3E
Extra Details:: Granzyme B, also known as GZMB, is the most prominent member of the granzyme family of cell death-inducing serine proteases expressed in the granules of cytotoxic T lymphocytes (CTLs) and NK cells. Granzyme B enters the target cells depending on another membrane-binding granule protein, perforin, results in the activation of effector caspases and mitochondrial depolarization through caspase-dependent and -independent pathways, and consequently induces rapid cell apoptosis. Over 3 substrates of GZMB have been identified including the key substrate caspase-3, ICAD, and Bid. GZMB is suggested to protect the host by lysing cells bearing on their surface 'nonself' antigens such as bacterial and viral infected-cells and tumor cells and accordingly plays an essential role in immunosurveillance.

Shipping Conditions:: Blue Ice