Recombinant Mouse Alkaline phosphatase (Intestinal type)/ALPI Protein

Size

£145.00

SKU:: RP02846
Additional Names:: Alkaline phosphatase,Alpi
Molecular Weight:: 60-75 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ile21-Gly501
Formulation:: Recombinant Mouse Alkaline phosphatase (Intestinal type)/ALPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile21-Gly501) of mouse Alkaline phosphatase (Accession #NP_001074551.1) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: IIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAG
Uniprot:: F8VPQ6
Synonyms:: 2010001C14Rik;Akp6;alkaline phosphatase 6;gIAP;intestinal alkaline phosphatase
Extra Details:: Alkaline phosphatase can be considered "our favorite enzyme" for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.

Shipping Conditions:: Blue Ice