RP02835
Recombinant Human Glycophorin-A/GYPA/CD235a protein
Size
£145.00
- SKU:
- RP02835
- Additional Names:
- CD235a|GPA|GPErik|GpMiIII|GPSAT|GYPA|HGpMiIII|HGpMiV|HGpMiX|HGpMiXI|HGpSta(C)|MN|MNS|PAS-2
- Molecular Weight:
- 45-65 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Leu20-Glu91
- Formulation:
- Recombinant Human Glycophorin-A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Glu91) of human Glycophorin-A (Accession #NP_002090.4) fused with a hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
- Uniprot:
- P02724-1
- Synonyms:
- CD235a;erythroid-lineage-specific membrane sialoglycoprotein;glycophorin A (MN blood group);glycophorin A, GPA;glycophorin Erik;glycophorin MiI;glycophorin MiV;glycophorin SAT;glycophorin Sta type C;glycophorin-A;GPA;GPErik;GPSAT;HGpMiV;HGpMiXI;HGpSta(C);Mi.V glycoprotein (24 AA);MN;MN sialoglycoprotein;MNS;PAS-2;recombinant glycophorin A-B Miltenberger-DR;sialoglycoprotein alpha
- Extra Details:
- Granulomatosis with polyangiitis (GPA) presents a wide spectrum of manifestations from the common respiratory symptoms to infrequent neurological and cardiac complications. The challenge in diagnosis and management makes the rapidly progressive disorder one of the most challenging dilemmas in clinical medicine.The ultimate goal is an improved prognosis through outcome measures which assesses the disease control with minimal adverse effects of intensive immunosuppressive regimens, an integral part of the clinical approach to improve the quality of life of GPA patients.
- Shipping Conditions:
- Blue Ice