RP02834
Recombinant Human GPX4 Protein
Size
£621.00
- SKU:
- RP02834
- Additional Names:
- GPx-4|GPX4|GSHPx-4|MCSP|PHGPx|SMDS|snGPx|snPHGPx
- Molecular Weight:
- 20-25 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gly26-Phe197,U73C
- Formulation:
- Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession #NP_002076.2) fused with a 6xHis tag at the N-terminus.
- Species:
- Human
- Sequence:
- GTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
- Uniprot:
- P36969
- Synonyms:
- epididymis secretory sperm binding protein;Glutathione peroxidase 4;GPx-4;GSHPx-4;MCSP;PHGPx;phospholipid hydroperoxidase;phospholipid hydroperoxide glutathione peroxidase;phospholipid hydroperoxide glutathione peroxidase, mitochondrial;selenoprotein GPX4;SMDS;snGPx;snPHGPx;sperm nucleus glutathione peroxidase
- Shipping Conditions:
- Blue Ice