Recombinant Mouse/Rat Flt4 ligand/VEGF-C Protein

Size

£163.00

SKU:: RP02804
Additional Names:: VEGF-C|VEGFC,Flt4-L,LMPH1D,VRP
Molecular Weight:: 20-25 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala108-Arg223
Formulation:: Recombinant Mouse/Rat VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala108-Arg223) of mouse/rat VEGF-C (Accession #NP_033532.1) fused with a 6xHis tag at the C-terminus.
Species:: Mouse, Rat
Sequence:: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Uniprot:: P97953
Synonyms:: AW228853;flt4 ligand;flt4-L;vascular endothelial growth factor C;vascular endothelial growth factor-related protein;VEGF-;VEGF-C;VRP
Extra Details:: Vascular endothelial growth factor C (VEGF-C) is a member of the VEGF family. Upon biosynthesis, VEGF-C protein is secreted as a non-covalent momodimer in an anti-parellel fashion. VEGF-C protein is a dimeric glycoprotein, as a ligand for two receptors, VEGFR-3 (Flt4), and VEGFR-2. VEGF-C may function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis. VEGF-C protein is over-expressed in various human cancers including breast cancer and prostate cancer. VEGF-C/VEGFR-3 axis, through different signaling pathways, plays a critical role in cancer progression by regulating different cellular functions, such as invasion, proliferation, and resistance to chemotherapy. Thus, targeting the VEGF-C/VEGFR-3 axis may be therapeutically significant for certain types of tumors.

Shipping Conditions:: Blue Ice