Recombinant Human AMBP Protein

Size

£145.00

SKU:: RP02794
Additional Names:: A1M|AMBP|EDC1|HCP|HI30|IATIL|ITI|ITIL|ITILC|UTI
Molecular Weight:: 33 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly20-Val203
Formulation:: Recombinant Human AMBP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly20-Val203) of human AMBP (Accession #NP_001624.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
Uniprot:: P02760
Synonyms:: A1M;bikunin;complex-forming glycoprotein heterogeneous in charge;EDC1;growth-inhibiting protein 19;HCP;HI30;IATIL;inter-alpha-trypsin inhibitor light chain;ITI;ITIL;ITILC;protein AMBP;protein HC;trypstatin;uristatin;uronic-acid-rich protein;UTI
Extra Details:: Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: A Alpha-1-microglobulin, inter-A Alpha-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. A Alpha-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-A Alpha-trypsin inhibitor is present in the plasma and urine. A Alpha-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-A Alpha-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.

Shipping Conditions:: Blue Ice