RP02748B
Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling)
Size
£657.00
- SKU:
- RP02748B
- Additional Names:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Molecular Weight:
- 58-62 kDa(CD3E), 44-46 kDa (CD3D)
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln22-Asp117(CD3E)&Phe22-Ala105(CD3D)
- Formulation:
- Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling) is produced by Expi293 expression system. The target protein is expressed with sequence (Gln22-Asp117(CD3E)&Phe22-Ala105(CD3D)) of Cynomolgus CD3E&CD3D fused with a hFc tag at the C-terminal.
- Species:
- Non-human Primate
- Sequence:
- QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Uniprot:
- Q95LI5.2, Q95LI8
- Synonyms:
- CD3 delta;CD3d molecule, delta (CD3-TCR complex);T-cell receptor T3 delta chain;T-cell surface glycoprotein CD3 delta chain
- Extra Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Shipping Conditions:
- Blue Ice