RP02654
Recombinant Human IL-15RA&IL-15 Protein
Size
£431.00
- SKU:
- RP02654
- Additional Names:
- IL-15 R alpha; CD215; IL15RA; IL-15RA; IL-15R-alpha1; Interleukin-15; IL-15; IL15
- Molecular Weight:
- 26-28, 30-32 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15)
- Formulation:
- Recombinant Human IL-15RA&IL-15 Protein is expressed from Expi293 with His tag at the C-terminal.; It contains Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15).
- Species:
- Human
- Sequence:
- ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
- Uniprot:
- P40933-1, Q13261-1
- Synonyms:
- CD215;IL-15;interleukin 15 receptor, alpha;interleukin-15;interleukin-15 receptor subunit alpha
- Extra Details:
- Interleukin-15 receptor alpha (IL-15R alpha) is a high affinity IL-15 binding protein that is crucial for mediating IL-15 functions such as memory CD8 T cell proliferation and NK, NK/T cell, and intestinal intraepithelial lymphocyte development.
- Shipping Conditions:
- Blue Ice