Recombinant Cynomolgus/Rhesus macaque TNFRSF9/4-1BB Protein

Size

£353.00

SKU:: RP02643
Additional Names:: 4-1BB|4-1BB ligand receptor|41BB|CD137|CDw137|FLJ43501|ILA|T cell antigen ILA|TNFRSF9
Molecular Weight:: 30-40 kDa
Species Reactivity:: Non-human Primate
Purity:: ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu24-Gln186
Formulation:: Recombinant CynomolgusTNFRSF9/4-1BB Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Leu24-Gln186) of Cynomolgus TNFRSF9 fused with His tag at the C-terminus.
Species:: Non-human Primate
Sequence:: LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ
Synonyms:: CD137;EGK_00183;tumor necrosis factor receptor superfamily member 9;tumor necrosis factor receptor superfamily, member 9
Extra Details:: 4-1BB, is also known as CD137, is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily.CD137 can be expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, CD137 expression is found on dendritic cells, B cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation.