RP02640
Recombinant Cynomolgus Fc gamma RIII/CD16 Protein
Size
£285.60
Was £336.00
- SKU:
- RP02640
- Additional Names:
- CD16|CD16A|Fc-gamma RIII|FCG3|FCGR3|FcgRIII|FCR-10|FcRIII|FCRIIIA|IGFR3|IgG Fc receptor III|IMD20
- Molecular Weight:
- 45-55 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gly17-Gln208
- Formulation:
- Recombinant Cynomolgus Fc gamma RIII/CD16 Protein is expressed from Expi293 with His tag at the C-terminal.; It contains Gly17-Gln208.
- Species:
- Non-human Primate
- Sequence:
- GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ
- Uniprot:
- Q8SPW2-1
- Synonyms:
- Fc-gamma receptor 3A;Fc-gamma RIII;Fc-gamma RIII-alpha;Fc-gamma RIIIa;fcgammaRIIIa;FCGR;FCGR3;FcRIII;IgG Fc receptor III;IgG Fc receptor III-A;Low affinity immunoglobulin gamma Fc region receptor III;low affinity immunoglobulin gamma Fc region receptor III-A;LOW QUALITY PROTEIN: low affinity immunoglobulin gamma Fc region receptor III
- Extra Details:
- Immunoglobulin G (IgG) Fc receptors play a critical role in linking IgG antibody-mediated immune responses with cellular effector functions. A high resolution map of the binding site on human IgG1 for human Fc gamma RI, Fc gamma RIIA, Fc gamma RIIB, Fc gamma RIIIA, and FcRn receptors has been determined.A common set of IgG1 residues is involved in binding to all Fc gamma R; Fc gamma RII and Fc gamma RIII also utilize residues outside this common set.
- Shipping Conditions:
- Blue Ice