Recombinant Human TSLPR Protein

Size

£395.00

SKU:: RP02623
Additional Names:: CRL2|CRLF2|CRLF2Y|IL-XR|p2RY8/CRLF2 fusion|TSLP receptor|TSLPR
Molecular Weight:: 60-75 kDa
Purity:: ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly25-Lys231
Formulation:: Recombinant Human TSLPR Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Gly25-Lys231.
Species:: Human
Sequence:: GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Uniprot:: Q9HC73-1
Synonyms:: CRL2;CRLF2Y;cytokine receptor CRL2 precusor;Cytokine receptor-like 2;cytokine receptor-like factor 2;IL-XR;thymic stromal lymphopoietin protein receptor;thymic stromal-derived lymphopoietin receptor;TSLP receptor;TSLPR
Extra Details:: Thymic stromal lymphopoietin (TSLP) is an interleukin-7 (IL-7) like cytokine, which plays an important role in the regulation of immune responses to allergens. TSLP binds to a heterodimeric receptor complex composed of the IL-7 receptor alpha chain (IL-7Ralpha) and the TSLP receptor (TSLPR, also known as CRLF2).