RP02616
Recombinant Human OSCAR Protein

Size
£395.00
- SKU:
- RP02616
- Additional Names:
- MGC33613|mOSCAR|OSCAR|PIgR-3|PIGR3|Poly-Ig receptor 3
- Molecular Weight:
- 60-70 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp19-Ser229
- Formulation:
- Recombinant Human OSCAR Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Asp19-Asn229.
- Species:
- Human
- Sequence:
- DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASS
- Uniprot:
- Q8IYS5-1
- Synonyms:
- osteoclast associated receptor OSCAR-S1;osteoclast associated receptor OSCAR-S2;osteoclast associated, immunoglobulin-like receptor;osteoclast-associated immunoglobulin-like receptor;PIgR-3;PIGR3;poly-Ig receptor 3;polymeric immunoglobulin receptor 3
- Extra Details:
- Osteoclast-associated receptor (OSCAR) is a co-stimulatory receptor in osteoclastogenesis. Synovial tissues from active rheumatoid arthritis (RA) patients express higher levels of OSCAR compared with osteoarthritic and normal patients. OSCAR and tartrate-resistant acid phosphatase (TRAP) expression levels did not differ between the cartilage pannus junction (CPJ) and non-CPJ regions in active RA.
- Shipping Conditions:
- Blue Ice





