Recombinant Human OSCAR Protein

Size

£395.00

SKU:: RP02616
Additional Names:: MGC33613|mOSCAR|OSCAR|PIgR-3|PIGR3|Poly-Ig receptor 3
Molecular Weight:: 60-70 kDa
Purity:: ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asp19-Ser229
Formulation:: Recombinant Human OSCAR Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Asp19-Asn229.
Species:: Human
Sequence:: DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASS
Uniprot:: Q8IYS5-1
Synonyms:: osteoclast associated receptor OSCAR-S1;osteoclast associated receptor OSCAR-S2;osteoclast associated, immunoglobulin-like receptor;osteoclast-associated immunoglobulin-like receptor;PIgR-3;PIGR3;poly-Ig receptor 3;polymeric immunoglobulin receptor 3
Extra Details:: Osteoclast-associated receptor (OSCAR) is a co-stimulatory receptor in osteoclastogenesis. Synovial tissues from active rheumatoid arthritis (RA) patients express higher levels of OSCAR compared with osteoarthritic and normal patients. OSCAR and tartrate-resistant acid phosphatase (TRAP) expression levels did not differ between the cartilage pannus junction (CPJ) and non-CPJ regions in active RA.