Recombinant Mouse IL-18 Protein

Size

POA

SKU:: RP02521
Additional Names:: Ig, Il-, Igif, Il-18,IL18
Molecular Weight:: 15-25 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asn36-Ser192
Formulation:: Recombinant Mouse IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn36-Ser192) of Mouse IL-18 fused with His tag at the C-terminus
Species:: Mouse
Sequence:: NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Uniprot:: P70380
Synonyms:: IFN-gamma-inducing factor;Ig;Igif;Il-;IL-1 gamma;Il-18;interferon gamma-inducing factor;interleukin-1 gamma;interleukin-18
Extra Details:: Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-G Gamma (IFN-G Gamma) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.

Shipping Conditions:: Blue Ice