RP02518
Recombinant Mouse IL-1 alpha Protein
Size
£145.00
- SKU:
- RP02518
- Additional Names:
- Il1a , Interleukin-1 alpha, IL-1 alpha
- Molecular Weight:
- 15-25 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser115-Ser270
- Formulation:
- Recombinant Mouse IL-1 alpha Protein is produced by E. coli cells expression system. The target protein is expressed with sequence (Ser115-Ser270) of Mouse IL-1 alpha(Accession # P01582) fused with No tag .
- Species:
- Mouse
- Sequence:
- SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
- Uniprot:
- P01582
- Synonyms:
- Il;IL-1 alpha;Il-1a;interleukin-1 alpha
- Extra Details:
- Interleukin 1 alpha (IL-1A Alpha) also known as hematopoietin 1 is a cytokine of the interleukin 1 family that in humans is encoded by the IL1A gene. IL-1A Alpha is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. It binds to the interleukin-1 receptor. It is on the pathway that activates tumor necrosis factor-alpha.
- Shipping Conditions:
- Blue Ice