RP02215
Recombinant Mouse CD3E&CD3D Protein
Size
£508.00
- SKU:
- RP02215
- Additional Names:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Molecular Weight:
- 50-65 kDa (CD3E), 40-50 kDa(CD3D)
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE.≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp23-Asp108(P22646)&Phe22-Ala105(P04235)
- Formulation:
- Recombinant Mouse CD3E&CD3D Heterodimer Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp23-Asp108(P22646)&Phe22-Ala105(P04235)) of mouse CD3E&CD3D (Accession #) fused with a hFc tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA
- Uniprot:
- P04235, P22646
- Synonyms:
- AI504783;CD3;CD3epsilon;T-cell receptor T3 delta chain;T-cell surface antigen T3/Leu-4 epsilon chain;T-cell surface glycoprotein CD3 delta chain;T-cell surface glycoprotein CD3 epsilon chain;T3d;T3e
- Extra Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Shipping Conditions:
- Blue Ice