Recombinant Human VSIG8 Protein

Size

£145.00

SKU:: RP02169
Additional Names:: VSIG8, C1orf204, VSIG8
Molecular Weight:: 28-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val22-Gly263
Formulation:: Recombinant Human VSIG8 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Val22-Gly263) of human VSIG8 (Accession #Q5VU13) fused with a 6xHis tag at the C- terminus.
Species:: Human
Sequence:: VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
Uniprot:: Q5VU13
Synonyms:: Small nucleolar RNA host gene 2;V-set and immunoglobulin domain-containing protein 8;VSIG8 overlapping transcript protein
Extra Details:: V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.