Recombinant Human PRL-2 Protein

Size

£145.00

SKU:: RP02140
Additional Names:: PTP4A2,HH13,HH7-2,HU-PP-1,OV-1,PRL-2,PRL2,PTP4A,PTPCAAX2,ptp-IV1a,ptp-IV1b
Molecular Weight:: 18 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Gln167
Formulation:: Recombinant Human PRL-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Gln167) of human PRL2 (Accession #Q12974) fused with a 6xHis tag at the C- terminus.
Species:: Human
Sequence:: MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Uniprot:: Q12974
Synonyms:: HH13;HH7-2;HU-PP-1;OV-1;phosphatase of regenerating liver 2;PRL-2;PRL2;protein tyrosine phosphatase IVA;protein tyrosine phosphatase IVA2;protein tyrosine phosphatase type IVA 2;protein tyrosine phosphatase type IVA, member 2;Protein-tyrosine phosphatase 4a2;protein-tyrosine phosphatase of regenerating liver 2;ptp-IV1a;ptp-IV1b;PTP(CAAXII);PTP4A;PTPCAAX2
Extra Details:: PTP4A2, also known as PRL2 or PTPCAAX2, is short for Protein tyrosine phosphatase type IVA 2. This protein exists in cell membrane, cytoplasm,endosome and membrane. PTP4A2 is often farnesylated during post-translational modification. Farnesylation is required for membrane targeting and for interaction with RABGGTB. The unfarnesylated forms are redirected to the nucleus and cytosol. It can stimulate progression from G1 into S phase during mitosis and promotes tumors. It also inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.

Shipping Conditions:: Blue Ice