RP02061
Recombinant Cynomolgus CD3E&CD3D Protein
Size
£508.00
- SKU:
- RP02061
- Additional Names:
- CD3 epsilon&CD3 delta|CD3E&CD3D
- Molecular Weight:
- 58-62 kDa (CD3E), 44-46 kDa (CD3D)
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln22-Asp117(Q95LI52)&Phe22-Ala105(Q95LI8)
- Formulation:
- Recombinant Cynomolgus CD3E&CD3G Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Phe22-Ala105 (Q95LI8) ) of cynomolgus CD3E&CD3D (Accession #Q95LI5.2 & Q95LI8) fused with an Fc tag at the C-terminus.
- Species:
- Non-human Primate
- Sequence:
- QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDFKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA
- Uniprot:
- Q95LI5.2, Q95LI8
- Synonyms:
- CD3 delta;CD3 epsilon FN18-;CD3 epsilon FN18+;CD3d molecule, delta (CD3-TCR complex);CD3e molecule, epsilon (CD3-TCR complex);T-cell receptor T3 delta chain;T-cell surface glycoprotein CD3 delta chain;T-cell surface glycoprotein CD3 epsilon chain
- Extra Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Shipping Conditions:
- Blue Ice