Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Size

£133.00

SKU:: RP02008
Additional Names:: AGPT2, ANG2,ANGPT2,ANG2
Molecular Weight:: 35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Lys275-Phe496
Formulation:: Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by mammalian expression system. The target protein is expressed with sequence (Lys275-Phe496) of human Angiopoietin-2/ANGPT2 (Accession #O15123) fused with 6xHis at the C-terminus.
Species:: Human
Sequence:: KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Uniprot:: O15123-1
Synonyms:: AGPT2;ANG2;angiopoietin-2;angiopoietin-2a;angiopoietin-2B;LMPHM10;Tie2-ligand
Extra Details:: Angiopoietin-2 (Ang-2; also ANGPT2) is a secreted glycoprotein that plays a complex role in angiogenesis and inflammation . Mature Ang-2 is 478 amino acids in length.Ang2 is widely expressed during development, but it is restricted postnatally to highly angiogenic tissues such as the placenta, ovaries, and uterus. It is particularly abundant in vascular endothelial cells (EC) where it is stored in intracellular Weibel Palade bodies.