RP02006
Recombinant Human CD3 delta Protein
Size
£336.00
- SKU:
- RP02006
- Additional Names:
- CD3D,CD3-DELTA,IMD19,T3D, IMD19, T3D
- Molecular Weight:
- 15 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Phe22-Ala105
- Formulation:
- Recombinant Human CD3 delta Protein is produced by mammalian expression system. The target protein is expressed with sequence (Phe22-Ala105) of Human CD3 delta (Accession #P04234) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Uniprot:
- P04234
- Synonyms:
- CD3 antigen, delta subunit;CD3 delta;CD3-DELTA;CD3d antigen, delta polypeptide (TiT3 complex);CD3d molecule, delta (CD3-TCR complex);IMD19;OKT3, delta chain;T-cell receptor T3 delta chain;T-cell surface glycoprotein CD3 delta chain;T3D
- Extra Details:
- T-cell surface glycoprotein CD3 delta chain, also known as CD3D, is a single-pass type I membrane protein.In immunology, the CD3 (cluster of differentiation 3) T cell co-receptor helps to activate both the cytotoxic T cell (CD8+ naive T cells) and also T helper cells (CD4+ naive T cells). It consists of a protein complex and is composed of four distinct chains. In mammals, the complex contains a CD3G Gamma chain, a CD3D Delta chain, and two CD3E Epsilon chains.
- Shipping Conditions:
- Blue Ice