Recombinant Human LRG1(P133S) Protein

Size

£145.00

SKU:: RP01986
Additional Names:: LRG1, LRG,Leucine-rich alpha-2-glycoprotein, LRG
Molecular Weight:: 45-55 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Vla36-Gln347 (Pro133Ser)
Formulation:: Recombinant Human LRG1(P133S) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Vla36-Gln347 (Pro133Ser) ) of Human LRG1(P133S) (Accession #NP_443204.1) fused with His tag at the C-terminus.
Species:: Human
Sequence:: VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Uniprot:: P02750
Synonyms:: 1300008B03Rik;2310031E04Rik;HMFT1766;leucine rich alpha 2 glycoprotein;leucine-rich alpha-2-glycoprotein;LRG
Extra Details:: Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.

Shipping Conditions:: Blue Ice