Recombinant Human FCRL2/FCRH2 /IRTA4 Protein

Size

£181.00

SKU:: RP01984
Additional Names:: FCRL2, FCRH2, IFGP4, IRTA4, SPAP1, UNQ9236/PRO31998, Fc receptor-like protein 2, FcR-like protein 2, FcRL2, Fc receptor homolog 2, FcRH2, IFGP family protein 4, Immunoglobulin receptor translocation-associated protein 4, SH2 domain-containing phosphatase anchor protein 1, CD307b
Molecular Weight:: 60-75 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu20-Asp395
Formulation:: Recombinant Human FCRL2/FCRH2 /IRTA4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp395) of Human FCRL2/FCRH2 /IRTA4 (Accession #NP_110391.2) fused with His at the C-terminus.
Species:: Human
Sequence:: LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD
Uniprot:: Q96LA5
Synonyms:: CD307b;fc receptor homolog 2;Fc receptor-like protein 2;FCRH2;IFGP family protein 4;IFGP4;immune receptor translocation-associated protein 4;immunoglobulin receptor translocation-associated protein 4;immunoglobulin superfamily Fc receptor, gp42;IRTA4;SH2 domain containing phosphatase anchor protein 1;SH2 domain-containing phosphatase anchor protein 1;SPAP1;SPAP1A;SPAP1B;SPAP1C
Extra Details:: FCRL2/FCRH2 /IRTA4, belongs to the family of glycoprotein homologs of classical immunoglobulin (Ig) Fc receptors. In human, the type I transmembrane FCRL protein family contains from three to nine immunoglobulin-like domains . Mature human FcRH2 consists of a 382 amino acid (aa) extracellular domain (ECD) with four Ig-like C2-set domains, a 21 aa transmembrane segment, and an 86 aa cytoplasmic domain with one ITAM-like, and two ITIM-like motifs. Alternate splicing of human FCRL2 may generate isoforms with N-terminal, internal, or C-terminal deletions . The gene for FcRH2 maps to the human Iq21-23 locus which is a hotspot for chromosomal translocation events associated with B cell malignancies . Although there are several Fc receptor-like genes in the mouse, none of these is a clear ortholog to human FCRL2 . FCRL proteins are differentially expressed among B cells . FCRL2 is preferentially expressed on naive and CD27+ memory B cells within the spleen, lymph nodes, tonsils, and peripheral blood . It is also expressed on most B cells in B cell chronic lymphocytic leukemia (B-CLL) patients. FCRL2 upregulation is associated with mutation of the immunoglobulin heavy chain variable (IGHV) and less aggressive forms of B-CLL.

Shipping Conditions:: Blue Ice