Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein

Size

£193.00

SKU:: RP01978
Additional Names:: Klrb1c, Ly55c, Nkrp1c,Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c, Ly-55c, NK1.1, NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40, NKR-P1 40, CD161c
Molecular Weight:: 25-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln67-Ser223
Formulation:: Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln67-Ser223) of Mouse Nkrp1c/NK1.1/CD161c (Accession #NP_001153376.1) fused with HIS and AVI at the N-terminus.
Species:: Mouse
Sequence:: QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
Uniprot:: P27814
Synonyms:: AI462337;CD161;CD161 antigen-like family member C;killer cell lectin-like receptor subfamily A member 1C;killer cell lectin-like receptor subfamily B member 1C;Klrb1b;Ly-5;ly-55c;Ly-59;Ly5;Ly55;Ly55c;Ly59;lymphocyte antigen 55 complex, locus C;lymphocyte antigen 55c;lymphocyte antigen 59;natural killer cell receptor protein NKR-P1C;natural killer cell receptor-P1;natural killer cell surface protein P1-40;natural killer cell-associated antigen 1;Nk;NK-;Nk-1;NK-1.;Nk-1.2;NK-RP1;Nk1;Nk1.;NK1.1;Nk1.2;NKR;NKR-;NKR-P1 40;NKR-P1.9;NKR-P1B;NKR-P1C;Nkrp;NKRP1;NKRP140;Nkrp1b;Nkrp1c
Extra Details:: Plays a stimulatory role on natural killer (NK) cells cytotoxicity. Activation by cross-linking of the receptor induces Ca2+ mobilization and interferon-gamma production.

Shipping Conditions:: Blue Ice