Recombinant Mouse Orosomucoid-1/ORM1 Protein

Size

£145.00

SKU:: RP01968
Additional Names:: Orm1,Agp1, Orm-1,Agp-1,Agp-2, Orm-1,Alpha-1-acid glycoprotein 1,AGP 1,Orosomucoid-1 (OMD 1)
Molecular Weight:: 25-45 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln19-207Ala
Formulation:: Recombinant Mouse Orosomucoid-1/ORM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-207Ala) of Mouse Orosomucoid-1/ORM1(Accession #NP_032794.1) fused with His at the C-terminus.
Species:: Mouse
Sequence:: QNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
Uniprot:: Q60590
Synonyms:: Agp;AGP 1;Agp-1;Agp-2;alpha-1-acid glycoprotein 1;OMD 1;Orm;Orm-1;Orosomucoid-1
Extra Details:: Orosomucoid-1/ORM1 as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain , Appears to function in modulating the activity of the immune system during the acute-phase reaction