RP01955
Recombinant Human Lipocalin-2/NGAL/LCN2 Protein
Size
£133.00
- SKU:
- RP01955
- Additional Names:
- LCN2, HNL, NGAL,Neutrophil gelatinase-associated lipocalin, NGAL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin, p25
- Molecular Weight:
- 20-25 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln21-Gly198
- Formulation:
- Recombinant Human Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Gly198)of Human Lipocalin-2/NGAL/LCN2 (Accession #NP_005555.2) fused with a His tag at the C-terminus.
- Species:
- Human
- Sequence:
- QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
- Uniprot:
- P80188
- Synonyms:
- 24p3;25 kDa alpha-2-microglobulin-related subunit of MMP-9;Lipocalin-2;migration-stimulating factor inhibitor;MSFI;neutrophil gelatinase-associated lipocalin;NGAL;oncogene 24p3;p25;siderocalin LCN2
- Extra Details:
- Lipocalin-2, also known as Neutrophil Gelatinase-Associated Lipocalin (NGAL), was originally identified as a component of neutrophil granules . It is a 25 kDa protein existing in monomeric and homo- and heterodimeric forms, the latter as a dimer with human neutrophil gelatinases (MMP-9) . Its expression has been observed in most tissues normally exposed to microorganism, and its synthesis is induced in epithelial cells during inflammation . Lipocalin-2 has been implicated in a variety of processes including cell differentiation, tumorigenesis, and apoptosis . Studies indicate that Lipocalin-2 binds a bacterial catecholate sidropore bound to ferric ion such as enterobactin with a subnanomolar dissociation constant . The bound ferric enterobactin complex breaks down slowly in a month into dihydroxybenzoyl serine and dihydroxybenzoic acid (DHBA). It also binds to a ferric DHBA complex with much less Kd values (7.9 nM) . Secretion of Lipocalin-2 in immune cells increases by stimulation of Toll-like receptor as an acute phase response to infection. As a result, it acts as a potent bacteriostatic reagent by sequestering iron . Moreover, Lipocalin-2 can alter the invasive and metastatic behavior of Ras-transformed breast cancer cells in vitro and in vivo by reversing epithelial to mesenchymal transition inducing activity of Ras, through restoration of E-cadherin expression, via effects on the Ras-MAPK signaling pathway .
- Shipping Conditions:
- Blue Ice