RP01950
Recombinant Human GDF15 Protein

Size
£134.00
- SKU:
- RP01950
- Additional Names:
- GDF15, MIC1, PDF, PLAB, PTGFB, Growth/differentiation factor 15, GDF-15, Macrophage inhibitory cytokine 1, MIC-1, NSAID-activated gene 1 protein, NAG-1, NSAID-regulated gene 1 protein, NRG-1, Placental TGF-beta, Placental bone morphogenetic protein, Prost
- Molecular Weight:
- 45 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala197-Ile308
- Formulation:
- Recombinant Human GDF15 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala197-Ile308)of Human GDF15 (Accession #NP_004855.2) fused with a hFc tag at the N-terminus.
- Species:
- Human
- Sequence:
- RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
- Uniprot:
- Q99988
- Synonyms:
- GDF-15;growth/differentiation factor 15;macrophage inhibitory cytokine 1;MIC-1;MIC1;NAG-1;non-steroidal anti-inflammatory drug-activated gene-1;NRG-1;NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1;NSAID-activated gene 1 protein;NSAID-regulated gene 1 protein;PDF;PLAB;placental bone morphogenetic protein;placental TGF-beta;prostate differentiation factor;PTGF-beta;PTGFB
- Extra Details:
- Growth-differentiation factor 15 (GDF15), also known as MIC-1, is a secreted member of the transforming growth factor (TGF)-B Beta superfamily, as a novel antihypertrophic regulatory factor in the heart. GDF-15 / GDF15 is not expressed in the normal adult heart but is induced in response to conditions that promote hypertrophy and dilated cardiomyopathy and it is expressed highly in liver. GDF-15 / GDF15 has a role in regulating inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF-15 / GDF15 is synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein. GDF-15 / GDF15 overexpression arising from an expanded erythroid compartment contributes to iron overload in thalassemia syndromes by inhibiting hepcidin expression.
- Shipping Conditions:
- Blue Ice

