Recombinant Human MMP-7 Protein

Size

£163.00

SKU:: RP01928
Additional Names:: MMP7, MPSL1, PUMP1,Matrilysin, 3.4.24.23, Matrin, Matrix metalloproteinase-7, MMP-7, Pump-1 protease, Uterine metalloproteinase
Molecular Weight:: 30-40 kDa
Purity:: ≥85%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Lys267
Formulation:: Recombinant Recombinant Human MMP-7 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Met1-Lys267) of Human MMP-7 (Accession #NP_002414.1) fused with a His tag at the C-terminus.
Species:: Human
Sequence:: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Uniprot:: P09237
Synonyms:: matrilysin;matrin;matrix metallopeptidase 7 (matrilysin, uterine);matrix metalloproteinase 7 (matrilysin, uterine);matrix metalloproteinase-7;MMP-7;MPSL1;PUMP-1;pump-1 protease;uterine matrilysin;uterine metalloproteinase
Extra Details:: MMP-7,Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.Matrix metalloproteinases (MMPs) are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-7 (matrilysin) is expressed in epithelial cells of normal and diseased tissues, and is capable of digesting a large series of proteins of the extracellular matrix including collagen IV and X, gelatin, casein, laminin, aggrecan, entactin, elastin and versican. MMP-7 is implicated in the activation of other proteinases such as plasminogen, MMP-1, MMP-2, and MMP-9. In addition to its roles in connective tissue remodeling and cancer, MMP-7 also regulates intestinal alpha -defensin activation in innate host defense, releases tumor necrosis factor-alpha in a model of herniated disc resorption, and cleaves FasL to generate a soluble form in a model of prostate involution. Structurally, MMP-7 is the smallest of the MMPs and consists of two domains: a pro-domain that is cleaved upon activation and a catalytic domain containing the zinc-binding site.

Shipping Conditions:: Blue Ice