Recombinant Rat Sonic hedgehog N-product/SHH Protein

Size

£145.00

SKU:: RP01896
Additional Names:: Shh, Vhh-1, Sonic hedgehog protein, SHH, 3.1.-.-, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC, Cleaved into: Sonic hedgehog protein N-product, ShhN, Shh N-terminal processed signaling domains, ShhNp
Molecular Weight:: 20-25 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala24-Gly198
Formulation:: Recombinant Rat Sonic hedgehog N-product/SHH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gly198) of Rat Sonic hedgehog /SHH (Accession #NP_058917.1) fused with a His tag at the C-terminus.
Species:: Rat
Sequence:: ACGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
Uniprot:: Q63673
Synonyms:: shh unprocessed N-terminal signaling and C-terminal autoprocessing domains;ShhNC;sonic hedgehog homolog;sonic hedgehog protein
Extra Details:: Sonic Hedgehog Protein (SHH, VHH-1) belongs to hedgehog protein family which includes Indian Hh, and Desert Hh. Hh family is involved in the cell fate and patterning during embryonic development, homeostasis, and adult tissue renewal . Similar to other member in the family, SHH binds to the patched (PTC) cell surface receptor, releasing the signal transducer Smoothened (Smo) to transmit the Hh signal into the cell and activate transcription of the target gene . Precursor SHH is autocatlytically cleaved into two subunits, N-terminal and C-terminal products. Soluble N-terminal product is involved in the signaling activity, while C-product displays an autoproteolysis activity on the precursor and a cholesterol transferase activity on the N-terminal product. C-terminal product attaches a cholesterol moiety to the N-terminal product, preventing N-terminal product diffusion within the developing embryo . A defect in SHH has been linked in holoprosencephaly type 3 (HPE3), in which developing forebrain fails to separate into right and left hemispheres, and ocular coloboma .

Shipping Conditions:: Blue Ice