RP01881
Recombinant Mouse IGF-II Protein

Size
£127.00
- SKU:
- RP01881
- Additional Names:
- C11orf43|chromosome 11 open reading frame 43|FLJ22066|FLJ44734|GRDF|IGF-2|IGF-II|IGF2|IGFII|insulin-like growth factor 2 (somatomedin A)|insulin-like growth factor II|insulin-like growth factor type 2|MSA|PEG2|PP9974|somatomedin-A
- Molecular Weight:
- 35-45kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala25-Glu91
- Formulation:
- Recombinant Mouse IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of Mouse IGF-II (Accession #NP_001116208.1) fused with a hFc at the C-terminus.
- Species:
- Mouse
- Sequence:
- AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
- Uniprot:
- P09535
- Synonyms:
- AL033362;Igf;Igf-;Igf-2;Igf-II;insulin-like growth factor II;M;M6;M6pr;Mpr;multiplication-stimulating polypeptide;Peg;Peg2
- Extra Details:
- IGF-II (Insulin-like growth factor II; also multiplication-stimulating polypeptide/MSP and somatomedin-A) is a secreted 8 kDa polypeptide that belongs to the insulin family of peptide growth factors. It is part of a complex system of growth and metabolic-regulating proteins that is particularly important during development. It has been associated with nervous system proliferation and differentiation, myelination, adrenal cortical proliferation, and skeletal growth and differentiation . In human, IGF-II is primarily synthesized by the liver, and circulates at high levels in both fetus and adult. In rodent, however, IGF-II levels drop after the perinatal period, an effect attributed to the lack of a key gene promoter . This may indicate that postnatally, IGF-II has either a limited, or local effect only in rodent. For example, evidence suggests IGF-II may be the intermediary for SHH induction of VEGF attendant with local neovascularization . Rodent cells known to express IGF-II include astrocytes , hepatocytes , osteoblasts , embryonic striated muscle cells plus Kupffer cells and Ito cells . Mouse IGF-II is synthesized as a 180 amino acid (aa) preproprecursor). It contains a 24 aa signal sequence, a 67 aa mature region, and an 89 aa C-terminal prodomain that is alternatively referred to as the E-peptide. Mature IGF-II is 91% and 97% aa identical to human and rat IGF-II, respectively. Proper processing of IGF-II requires the chaperone activity of GRP94 . This generates an 8 kDa mature form, an 18 kDa, 156 aa proform, and a potential 11 kDa, 88 aa "Big" form (aa 25-112). This 11 kDa "Big" form would be equivalent to human 15-16 kDa IGF-II, with the 5 kDa difference attributable to the presence of O-linked glycosylation . There is an additional 34 aa proteolytic fragment that is termed preptin and contains aa 93-126 of the preproprecursor. This is distinct from IGF-II, is secreted by pancreatic b cells, and facilitates insulin secretion. IGF-II has multiple binding partners. It binds to IGF-IR, the Insulin receptor (IR)-type A and IGF-IR:IR-A hybrids, the type 2 IGF receptor (IGF-2R), and IGF binding proteins 1-6 . The first three receptors initiate downstream signaling events, the IGF-2R sequesters local IGF-II, and the six IGFBPs regulate IGF-II activity in various tissues.
- Shipping Conditions:
- Blue Ice

