Recombinant Human IGF-II Protein

Size

£127.00

SKU:: RP01878
Additional Names:: IGF2,C11orf43,GRDF,IGF-II,PP9974
Molecular Weight:: 40-45 kDa
Purity:: 85%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: (Ala25-Glu91)
Formulation:: Recombinant Human IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of human IGF2 (Accession #P01344)fused with a hFc tag at the C-terminus.
Species:: Human
Sequence:: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Uniprot:: P01344-1
Synonyms:: C11orf43;GRDF;IGF-II;insulin-like growth factor 2 (somatomedin A);insulin-like growth factor II;insulin-like growth factor type 2;PP9974;preptin;Somatomedin-A;SRS3;T3M-11-derived growth factor
Extra Details:: This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.